WP_024131108.1 has 78 amino acids
Query: DUF1480 [M=78]
Accession: PF07351.17
Description: Protein of unknown function (DUF1480)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.6e-47 144.3 0.0 5e-47 144.2 0.0 1.0 1 WP_024131108.1
Domain annotation for each sequence (and alignments):
>> WP_024131108.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 144.2 0.0 5e-47 5e-47 3 78 .] 2 77 .. 1 77 [. 0.99
Alignments for each domain:
== domain 1 score: 144.2 bits; conditional E-value: 5e-47
DUF1480 3 ktklrisafeiddavlsseqkgertlsiPcksdpdlcmqldawdeetsiPailngkdsllyrkhydrqkdawvmrv 78
kt +ri+afeidda+l++e gertl+iPcksdpdlcmqldawd+ets+Pailng++s+l+r hyd ++dawvmr+
WP_024131108.1 2 KTSVRIGAFEIDDAELHGESPGERTLTIPCKSDPDLCMQLDAWDAETSVPAILNGEHSVLFRTHYDPKSDAWVMRL 77
89************************************************************************97 PP
Or compare WP_024131108.1 to CDD or PaperBLAST