WP_024131108.1 has 78 amino acids
Query: DUF1480 [M=78] Accession: PF07351.18 Description: Protein of unknown function (DUF1480) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-47 144.3 0.0 5e-47 144.2 0.0 1.0 1 WP_024131108.1 Domain annotation for each sequence (and alignments): >> WP_024131108.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 144.2 0.0 5e-47 5e-47 3 78 .] 2 77 .. 1 77 [. 0.99 Alignments for each domain: == domain 1 score: 144.2 bits; conditional E-value: 5e-47 DUF1480 3 ktklrisafeiddavlsseqkgertlsiPcksdpdlcmqldawdeetsiPailngkdsllyrkhydrqkdawvmrv 78 kt +ri+afeidda+l++e gertl+iPcksdpdlcmqldawd+ets+Pailng++s+l+r hyd ++dawvmr+ WP_024131108.1 2 KTSVRIGAFEIDDAELHGESPGERTLTIPCKSDPDLCMQLDAWDAETSVPAILNGEHSVLFRTHYDPKSDAWVMRL 77 89************************************************************************97 PP
Or compare WP_024131108.1 to CDD or PaperBLAST