WP_024776962.1 has 420 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1e-21 63.6 0.2 1.7e-21 62.8 0.2 1.3 1 WP_024776962.1
Domain annotation for each sequence (and alignments):
>> WP_024776962.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 62.8 0.2 1.7e-21 1.7e-21 34 129 .. 302 394 .. 293 411 .. 0.88
Alignments for each domain:
== domain 1 score: 62.8 bits; conditional E-value: 1.7e-21
EryCIII-like_C 34 RlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpayraaaaklaee 128
R +vP++ +lp +aa+vHhgG g+t+ a+ +GvPq+ p d++ +a r+ lG+g+ + ++ + ++s+a+a+ +v++ + ra+ + +
WP_024776962.1 302 R--RYVPMSRILPHSAALVHHGGVGTTALAMAAGVPQIATPFAHDQFDNAARMERLGCGMRVFPP-ASAESLAAALDKVLNSQEVRASCDRYRTL 393
4..79*******************************************************99876.67999***************999887765 PP
EryCIII-like_C 129 i 129
i
WP_024776962.1 394 I 394
5 PP
Or compare WP_024776962.1 to CDD or PaperBLAST