WP_029377026.1 has 363 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.7e-24 71.7 0.9 4.9e-24 70.9 0.9 1.5 1 WP_029377026.1
Domain annotation for each sequence (and alignments):
>> WP_029377026.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 70.9 0.9 4.9e-24 4.9e-24 1 79 [] 9 86 .. 9 86 .. 0.95
Alignments for each domain:
== domain 1 score: 70.9 bits; conditional E-value: 4.9e-24
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R+eI ei++e+l Ll++R ++a++i+e K+++g v+dp+Re+e++++l ++ +e +++++++++f+ei+++s +lQk
WP_029377026.1 9 RDEIVEINEEILGLLSKRGKIAQKIGEEKRKQGTLVYDPQREKEMINQLLDK-NEGPFNDNVIKQLFKEIFKASTDLQK 86
99*************************************************3.3566********************96 PP
Or compare WP_029377026.1 to CDD or PaperBLAST