WP_029516113.1 has 360 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-24 72.4 0.1 4.5e-24 71.0 0.1 1.8 2 WP_029516113.1
Domain annotation for each sequence (and alignments):
>> WP_029516113.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 71.0 0.1 4.5e-24 4.5e-24 1 79 [] 12 89 .. 12 89 .. 0.96
2 ? -3.5 0.0 0.81 0.81 23 37 .. 137 151 .. 134 153 .. 0.75
Alignments for each domain:
== domain 1 score: 71.0 bits; conditional E-value: 4.5e-24
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R+++d+ + +lleLl++R+ela + +++K+++g+p +dp Re+++l++l + a++ +d+ +++++f++i+++s+++Qk
WP_029516113.1 12 REQLDATNLQLLELLSQRAELAGQLGKLKEAQGVPDFDPVREQQMLDKLIA-ANRGPFDDATIRQLFKNIFKASLNYQK 89
99*************************************************.44556*********************6 PP
== domain 2 score: -3.5 bits; conditional E-value: 0.81
CM_2 23 keiaeyKkenglpvl 37
+e++++ ke+g+p+l
WP_029516113.1 137 REVGAALKEAGVPIL 151
677777779999987 PP
Or compare WP_029516113.1 to CDD or PaperBLAST