WP_029750077.1 has 258 amino acids
Query: AadA_C [M=103]
Accession: PF13427.10
Description: Aminoglycoside adenylyltransferase, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-39 120.8 0.0 1.8e-39 120.3 0.0 1.2 1 WP_029750077.1
Domain annotation for each sequence (and alignments):
>> WP_029750077.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 120.3 0.0 1.8e-39 1.8e-39 1 102 [. 149 250 .. 149 251 .. 0.99
Alignments for each domain:
== domain 1 score: 120.3 bits; conditional E-value: 1.8e-39
AadA_C 1 evldpvpredlvdailadveelleeieederyvvLtLaRvlatletgeilsKdeAaewalerlPeeyrpllaeArkaylgeeeekweedeeevee 95
ev++pvp++d+++ai++++++l+++i++der+v+LtLaR+++t +tgei+sKd Aaewa+++lP ey+ ll++A kaylge +kw++ e+ev+e
WP_029750077.1 149 EVIEPVPMTDIRKAIKESLPGLIASIKGDERNVILTLARMWLTASTGEIRSKDLAAEWAIPQLPFEYAILLDKASKAYLGEYIDKWKGMESEVTE 243
699******************************************************************************************** PP
AadA_C 96 fakymla 102
+++ym++
WP_029750077.1 244 LVNYMKK 250
*****97 PP
Or compare WP_029750077.1 to CDD or PaperBLAST