WP_029750077.1 has 258 amino acids
Query: AadA_C [M=103] Accession: PF13427.11 Description: Aminoglycoside adenylyltransferase, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-40 123.3 0.0 3.3e-40 122.8 0.0 1.2 1 WP_029750077.1 Domain annotation for each sequence (and alignments): >> WP_029750077.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 122.8 0.0 3.3e-40 3.3e-40 1 102 [. 149 250 .. 149 251 .. 0.99 Alignments for each domain: == domain 1 score: 122.8 bits; conditional E-value: 3.3e-40 HH-----HHHHHHHHHHHHHH-SSHHHH-HHHHHHHHHHHHHHHHHS----HHHHHHHHGGGS-HHHHHHHHHHHHHHTTS----HHHHHHHHHH CS AadA_C 1 evldpvpkedllkailadvkelleeieedernvvLtLaRvlatletgeilsKdaaaewalerlPeeyapllkqArkaylgeeeekweekeeevee 95 ev++pvp++d++kai++++++l ++i++dernv+LtLaR+++t +tgei+sKd aaewa+++lP eya ll++A kaylge +kw++ e+ev+e WP_029750077.1 149 EVIEPVPMTDIRKAIKESLPGLIASIKGDERNVILTLARMWLTASTGEIRSKDLAAEWAIPQLPFEYAILLDKASKAYLGEYIDKWKGMESEVTE 243 699******************************************************************************************** PP HHHHHHH CS AadA_C 96 fakymla 102 +++ym++ WP_029750077.1 244 LVNYMKK 250 *****97 PP
Or compare WP_029750077.1 to CDD or PaperBLAST