PaperBLAST – Find papers about a protein or its homologs

 

Align WP_033478380.1 to PF01817 (CM_2)

WP_033478380.1 has 189 amino acids

Query:       CM_2  [M=79]
Accession:   PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.7e-14   40.3   0.2    6.6e-14   38.4   0.0    1.9  2  WP_033478380.1  


Domain annotation for each sequence (and alignments):
>> WP_033478380.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   38.4   0.0   6.6e-14   6.6e-14      11      79 .]      37     105 ..      35     105 .. 0.96
   2 ?   -0.8   0.2      0.12      0.12       1      16 [.     129     144 ..     129     147 .. 0.91

  Alignments for each domain:
  == domain 1  score: 38.4 bits;  conditional E-value: 6.6e-14
            CM_2  11 lleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79 
                     l++ + +R ++ +++a  K ++g+pvld++Re++vl+ +r++a ++gld++ ++++f + i++ +++Q+
  WP_033478380.1  37 LMDRIVQRNAIGDAVALSKWDSGKPVLDQAREAAVLQSVRDQAPAHGLDADDAARFFGAQIEANKSVQY 105
                     678899***********************************************************9996 PP

  == domain 2  score: -0.8 bits;  conditional E-value: 0.12
            CM_2   1 RkeIdeiDrelleLla 16 
                     R+++d++  ell+ la
  WP_033478380.1 129 RARLDQLQGELLDALA 144
                     8999********9997 PP



Or compare WP_033478380.1 to CDD or PaperBLAST