WP_034082112.1 has 92 amino acids
Query: DUF559 [M=109]
Accession: PF04480.16
Description: Protein of unknown function (DUF559)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1e-27 82.5 0.1 1.2e-27 82.2 0.1 1.1 1 WP_034082112.1
Domain annotation for each sequence (and alignments):
>> WP_034082112.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 82.2 0.1 1.2e-27 1.2e-27 9 80 .. 11 81 .. 5 85 .. 0.94
Alignments for each domain:
== domain 1 score: 82.2 bits; conditional E-value: 1.2e-27
DUF559 9 klRreqteaekkLWrllrnrrlsglkfrRqkpigsYivDfvclkaklivelDGaqhdeeeeyDaeRtelLes 80
R++qteae++LW lr +rl glkfrRqk++g YivDf c + l++ lDG+qh+ ++ D R+++Le+
WP_034082112.1 11 VPRQRQTEAERALWLCLRGQRLLGLKFRRQKILGPYIVDFRCHERMLVIALDGGQHE-DSPADRLRDAWLER 81
569*****************************************************9.6788********97 PP
Or compare WP_034082112.1 to CDD or PaperBLAST