WP_034082112.1 has 92 amino acids
Query: DUF559 [M=109] Accession: PF04480.18 Description: Protein of unknown function (DUF559) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-27 82.5 0.1 1.2e-27 82.2 0.1 1.1 1 WP_034082112.1 Domain annotation for each sequence (and alignments): >> WP_034082112.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 82.2 0.1 1.2e-27 1.2e-27 9 80 .. 11 81 .. 5 85 .. 0.94 Alignments for each domain: == domain 1 score: 82.2 bits; conditional E-value: 1.2e-27 XXXXXX-HHHHHHHHHHGGGTTTT--EEEEEEETTEEEEEEETTTTEEEEEE-----------HHHHHHHHH CS DUF559 9 klRreqteaekkLWrllrnrrlsglkfrRqkpigsYivDfvclkaklivelDGaqhdeeeeyDaeRtelLes 80 R++qteae++LW lr +rl glkfrRqk++g YivDf c + l++ lDG+qh+ ++ D R+++Le+ WP_034082112.1 11 VPRQRQTEAERALWLCLRGQRLLGLKFRRQKILGPYIVDFRCHERMLVIALDGGQHE-DSPADRLRDAWLER 81 569*****************************************************9.6788********97 PP
Or compare WP_034082112.1 to CDD or PaperBLAST