WP_038231115.1 has 78 amino acids
Query: DUF2492 [M=77]
Accession: PF10678.13
Description: Protein of unknown function (DUF2492)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.8e-28 82.6 0.1 1.1e-27 82.5 0.1 1.0 1 WP_038231115.1
Domain annotation for each sequence (and alignments):
>> WP_038231115.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 82.5 0.1 1.1e-27 1.1e-27 2 77 .] 4 77 .. 3 77 .. 0.98
Alignments for each domain:
== domain 1 score: 82.5 bits; conditional E-value: 1.1e-27
DUF2492 2 siHgHevlelllasgesltrasLkeaieekFGeearFhtCsaedltaeeLiefLlkkgKfiesedglttnaekiCn 77
iH+H+vl+ll +++++tr++L++++ e+FG earF tCs e++++++L++f+ +k+K+ie+++ +n e++C+
WP_038231115.1 4 AIHAHKVLNLL--REQPMTREQLEQTVIEQFGTEARFRTCSREGFDLDSLLAFFVEKQKVIENQGVWELNIERVCS 77
59*********..**************************************************************6 PP
Or compare WP_038231115.1 to CDD or PaperBLAST