WP_038275136.1 has 66 amino acids
Query: DUF2065 [M=56]
Accession: PF09838.13
Description: Uncharacterized protein conserved in bacteria (DUF2065)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.2e-26 77.5 3.7 3.7e-26 77.3 3.7 1.0 1 WP_038275136.1
Domain annotation for each sequence (and alignments):
>> WP_038275136.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.3 3.7 3.7e-26 3.7e-26 1 56 [] 5 60 .. 5 60 .. 0.97
Alignments for each domain:
== domain 1 score: 77.3 bits; conditional E-value: 3.7e-26
DUF2065 1 LllAlGLvLviEGllpflaPerwrrmlaqlaelpdgqLRliGlvsmllGllllwlv 56
++lAlGLvLv+EGl p+l+P+ wr+m++++++lpd++LR++G++++++G+++++++
WP_038275136.1 5 IWLALGLVLVLEGLGPMLYPKTWRKMIQAMTQLPDSTLRRFGGGLVVAGFVIYYML 60
689**************************************************985 PP
Or compare WP_038275136.1 to CDD or PaperBLAST