WP_039510765.1 has 61 amino acids
Query: DUF2065 [M=56]
Accession: PF09838.13
Description: Uncharacterized protein conserved in bacteria (DUF2065)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.3e-24 70.4 7.2 5.8e-24 70.3 7.2 1.0 1 WP_039510765.1
Domain annotation for each sequence (and alignments):
>> WP_039510765.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 70.3 7.2 5.8e-24 5.8e-24 1 56 [] 4 59 .. 4 59 .. 0.98
Alignments for each domain:
== domain 1 score: 70.3 bits; conditional E-value: 5.8e-24
DUF2065 1 LllAlGLvLviEGllpflaPerwrrmlaqlaelpdgqLRliGlvsmllGllllwlv 56
+l Al+L+ viEGll+f+aP +w+rm++ql +lp++qLR iG+v ++lG++ lw+v
WP_039510765.1 4 FLSALCLIAVIEGLLLFAAPTAWKRMVEQLFSLPTAQLRAIGGVTLVLGAIALWVV 59
799***************************************************86 PP
Or compare WP_039510765.1 to CDD or PaperBLAST