WP_039804033.1 has 105 amino acids
Query: DUF1654 [M=70]
Accession: PF07867.15
Description: Protein of unknown function (DUF1654)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-28 84.4 0.1 2.4e-28 84.0 0.1 1.2 1 WP_039804033.1
Domain annotation for each sequence (and alignments):
>> WP_039804033.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 84.0 0.1 2.4e-28 2.4e-28 1 69 [. 16 84 .. 16 85 .. 0.97
Alignments for each domain:
== domain 1 score: 84.0 bits; conditional E-value: 2.4e-28
DUF1654 1 tsyerlgaRvqriinaPaaQksrvavvlrlegeseedWarlleelaeteevelafqdDgsvrvrWerpl 69
t+ erlg+Rv+++in P+aQ +r++ ++rl + ++ W++++e laet+++e+af dDgsv+++Wer++
WP_039804033.1 16 TPLERLGLRVSSMINTPKAQLERQVTIHRLATDPDDTWDEVMELLAETDGLEMAFSDDGSVTLKWERQT 84
678***************************************************************975 PP
Or compare WP_039804033.1 to CDD or PaperBLAST