WP_040081845.1 has 136 amino acids
Query: DUF1398 [M=119] Accession: PF07166.15 Description: Protein of unknown function (DUF1398) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-48 148.4 3.6 5.5e-48 148.3 3.6 1.0 1 WP_040081845.1 Domain annotation for each sequence (and alignments): >> WP_040081845.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 148.3 3.6 5.5e-48 5.5e-48 1 118 [. 8 125 .. 8 126 .. 0.99 Alignments for each domain: == domain 1 score: 148.3 bits; conditional E-value: 5.5e-48 DUF1398 1 kkafekvrsdadfpafiqelkrlgvshYeyfvatgnvkyvtendevvsvkakrellkvaekknaekikaalkkhqsgeitfeqfceelAkaGvfk 95 k++f++vr+d +++ f++elkr++vshY+y++atgn++ v++nd+ v +k+ +e+++v++++++++i++ ++k++s+eitf++++e+lAkaGvf+ WP_040081845.1 8 KEIFDQVRKDLNCDRFYSELKRHNVSHYIYYLATGNIHVVLKNDNAVLIKGLEEVVNVKFRRDTRLIETYSHKLKSREITFHEYRENLAKAGVFR 102 689******************************************************************************************** PP DUF1398 96 WivdlnektrsYydkdnslLlaE 118 W+++++e++r+Yy++dnslL++E WP_040081845.1 103 WVTNVHEHKRYYYTFDNSLLFTE 125 **********************9 PP
Or compare WP_040081845.1 to CDD or PaperBLAST