WP_045882056.1 has 134 amino acids
Query: DUF1090 [M=110]
Accession: PF06476.16
Description: Protein of unknown function (DUF1090)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-13 37.5 0.0 1.3e-13 37.3 0.0 1.1 1 WP_045882056.1
Domain annotation for each sequence (and alignments):
>> WP_045882056.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 37.3 0.0 1.3e-13 1.3e-13 12 109 .. 31 126 .. 20 127 .. 0.93
Alignments for each domain:
== domain 1 score: 37.3 bits; conditional E-value: 1.3e-13
DUF1090 12 aaalsgCaaKaqaiekqlsaAkahgnkarvagLekalaevkanCtdaslreereqkvaekeeevaereaeLaeaqekgdadkiakrqkkLaeaqe 106
+a+s C a+ +ai+ l++ a+ + ++ agL++ l+ ++ +C+ +l e++ +++e +v r+ eL++a++ gd++ i kr+++L+ a +
WP_045882056.1 31 PEATSSCLARGEAIKGSLEQLLAEPQYQQLAGLQRVLEPLSRYCD--GLHFEHNPPLRQAEYQVLLRQMELDAARDYGDPSIIGKRKARLTHALQ 123
57899***************************************5..78899999************************************9988 PP
DUF1090 107 eLk 109
L+
WP_045882056.1 124 VLQ 126
775 PP
Or compare WP_045882056.1 to CDD or PaperBLAST