WP_046719570.1 has 176 amino acids
Query: DUF2514 [M=161] Accession: PF10721.14 Description: Protein of unknown function (DUF2514) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-49 151.7 15.7 1.1e-48 151.5 15.7 1.0 1 WP_046719570.1 Domain annotation for each sequence (and alignments): >> WP_046719570.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 151.5 15.7 1.1e-48 1.1e-48 4 157 .. 12 165 .. 6 169 .. 0.92 Alignments for each domain: == domain 1 score: 151.5 bits; conditional E-value: 1.1e-48 DUF2514 4 lavvvllaaalvvG.fahGsakeeagweqkkadrdseqsqakvaaetaaRqeeqrrkaaaeearkdakeeaaaAradavgaaaegdrLrqeaakl 97 l++++ l ++G + hG ++++ +w+ k+a++ s+qs+a+++++t++R+eeqrr++aa+++++da++++ aA+ d + +a+g+ +r ea+k+ WP_046719570.1 12 LLILLALG-GALYGaYRHGVTVTDLAWKAKWAEQVSAQSEAVATTTTEYRTEEQRRQKAANQVANDARQNQTAAITDGSVDDASGELMRIEAGKM 105 33444444.457999******************************************************************************** PP DUF2514 98 aaarsavaadpaaadrgktaaraavvLadlLsrsaerarelAeaaDrariAgetCereYd 157 aa++s+v++d++a +rgk+a+raa+vL+dlL+r+++rarelA+a+D++riAg++C+r d WP_046719570.1 106 AATASCVPSDTGASERGKAATRAAMVLSDLLGRADARARELAKAYDQSRIAGQACNRFVD 165 ********************************************************9766 PP
Or compare WP_046719570.1 to CDD or PaperBLAST