WP_047127369.1 has 189 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1e-15 44.2 0.1 1e-14 41.0 0.0 2.1 2 WP_047127369.1
Domain annotation for each sequence (and alignments):
>> WP_047127369.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 41.0 0.0 1e-14 1e-14 11 79 .] 37 105 .. 35 105 .. 0.97
2 ? 0.8 0.0 0.035 0.035 1 17 [. 129 145 .. 129 148 .. 0.93
Alignments for each domain:
== domain 1 score: 41.0 bits; conditional E-value: 1e-14
CM_2 11 lleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
ll+ + +R ++ +++a K ++g+pvld+ Re++vl+ +re+a ++gld++ ++++f + i++ +a+Q+
WP_047127369.1 37 LLDRIVQRNAIGDAVALSKWDSGKPVLDQTREAAVLQSVREQAPAHGLDADDAARFFAAQIEANKAVQY 105
788999************************************************************996 PP
== domain 2 score: 0.8 bits; conditional E-value: 0.035
CM_2 1 RkeIdeiDrelleLlae 17
R+++d++ +ll+ lae
WP_047127369.1 129 RTRLDQLQGQLLDALAE 145
899***********997 PP
Or compare WP_047127369.1 to CDD or PaperBLAST