WP_050003583.1 has 211 amino acids
Query: CTP-dep_RFKase [M=121] Accession: PF01982.20 Description: Domain of unknown function DUF120 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-43 134.2 0.0 2.2e-43 133.4 0.0 1.4 1 WP_050003583.1 Domain annotation for each sequence (and alignments): >> WP_050003583.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 133.4 0.0 2.2e-43 2.2e-43 1 121 [] 92 209 .. 92 209 .. 0.97 Alignments for each domain: == domain 1 score: 133.4 bits; conditional E-value: 2.2e-43 CTP-dep_RFKase 1 VvsGlgeGkyyvslegykeqfeeklgfePypGTLNvkldeeslelrkaleklkgieiegfeeeertfgevkaypakiegieaavvvperthyped 95 VvsGlgeG+yyv++ y+ ++e+lgfePy GTLNv++ + +++ +al ++++++i+gf++++rtfg+vkay+++i+g+e+avvvp+rt +p++ WP_050003583.1 92 VVSGLGEGAYYVKQ--YSPLIQEYLGFEPYLGTLNVRVLFP-KTVFDALCNVRPVIIPGFTKGGRTFGDVKAYRVRIDGVEGAVVVPSRTVHPPK 183 89************..**********************999.557888999******************************************** PP CTP-dep_RFKase 96 vlEiiapvkLReklelkdgdeveiev 121 + Eiiapv+LRekl+lkdgd+v+iev WP_050003583.1 184 IAEIIAPVNLREKLGLKDGDRVRIEV 209 ************************97 PP
Or compare WP_050003583.1 to CDD or PaperBLAST