WP_053119933.1 has 106 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.8e-22 64.0 0.0 8.1e-22 63.8 0.0 1.1 1 WP_053119933.1
Domain annotation for each sequence (and alignments):
>> WP_053119933.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 63.8 0.0 8.1e-22 8.1e-22 1 78 [. 19 95 .. 19 96 .. 0.96
Alignments for each domain:
== domain 1 score: 63.8 bits; conditional E-value: 8.1e-22
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+eId +D+ ++Ll +R++++ ++ ++K+ + +v+ peR +++l+ +re+ae++gl+p+a+ek++ +++++++a +
WP_053119933.1 19 RSEIDTLDQAVIKLLGKRFQYVLAASAFKT-SATSVRAPERFKAMLATRREWAEAEGLSPDAIEKMYSDLVNHFIAEE 95
99***************************5.666****************************************9987 PP
Or compare WP_053119933.1 to CDD or PaperBLAST