WP_053191119.1 has 420 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.6e-22 63.6 0.2 1.6e-21 62.9 0.2 1.3 1 WP_053191119.1
Domain annotation for each sequence (and alignments):
>> WP_053191119.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 62.9 0.2 1.6e-21 1.6e-21 33 129 .. 301 394 .. 291 411 .. 0.88
Alignments for each domain:
== domain 1 score: 62.9 bits; conditional E-value: 1.6e-21
EryCIII-like_C 33 vRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpayraaaaklae 127
vR +vP++ +lp +aa+vHhgG g+t+ a+ +GvPq+ p d++ +a r+ lG+g+ + ++ + ++s+a+a+ +v++ + ra+ + +
WP_053191119.1 301 VR--RYVPMSRILPHSAALVHHGGVGTTALAMAAGVPQIATPFAHDQFDNAARMERLGCGMRVFPP-ASAESLAAALDKVLNSQEVRASCDRYRT 392
44..79*******************************************************99876.67999***************99988776 PP
EryCIII-like_C 128 ei 129
i
WP_053191119.1 393 LI 394
55 PP
Or compare WP_053191119.1 to CDD or PaperBLAST