WP_054062060.1 has 186 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.7e-16 45.0 0.2 1.2e-15 44.0 0.2 1.5 1 WP_054062060.1
Domain annotation for each sequence (and alignments):
>> WP_054062060.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 44.0 0.2 1.2e-15 1.2e-15 11 79 .] 34 102 .. 32 102 .. 0.96
Alignments for each domain:
== domain 1 score: 44.0 bits; conditional E-value: 1.2e-15
CM_2 11 lleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
ll+ ++eR+ +a ++a K ++g+pv d Re++v++++re+a++++l+pe v +++ + i++ + +Q+
WP_054062060.1 34 LLQTISERLTIANQVALTKWDSGKPVEDSTREQQVIANAREQAQAYQLKPEEVGQFIAAQIEANKLVQY 102
8999**********************************************************9998885 PP
Or compare WP_054062060.1 to CDD or PaperBLAST