WP_056432003.1 has 102 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1e-21 63.4 1.1 1.2e-21 63.2 1.1 1.1 1 WP_056432003.1
Domain annotation for each sequence (and alignments):
>> WP_056432003.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 63.2 1.1 1.2e-21 1.2e-21 1 78 [. 17 93 .. 17 94 .. 0.97
Alignments for each domain:
== domain 1 score: 63.2 bits; conditional E-value: 1.2e-21
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+ +d++Drel++Lla+R+++++++a++K +++ v+d++R +v++++r++a++lg+++ +v++i++ +++ s+a++
WP_056432003.1 17 RAGVDQLDRELVALLARRFAYMDAAARIKPTRD-RVRDEDRKTQVIDQARDEARRLGVPEAVVADIWEVLVEGSIAYE 93
8899*************************7666.9*****************************************98 PP
Or compare WP_056432003.1 to CDD or PaperBLAST