WP_062266039.1 has 222 amino acids
Query: CTP-dep_RFKase [M=121] Accession: PF01982.20 Description: Domain of unknown function DUF120 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-48 149.8 0.0 3.3e-48 149.0 0.0 1.4 1 WP_062266039.1 Domain annotation for each sequence (and alignments): >> WP_062266039.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 149.0 0.0 3.3e-48 3.3e-48 1 121 [] 99 219 .. 99 219 .. 0.99 Alignments for each domain: == domain 1 score: 149.0 bits; conditional E-value: 3.3e-48 CTP-dep_RFKase 1 VvsGlgeGkyyvslegykeqfeeklgfePypGTLNvkldeeslelrkaleklkgieiegfeeeertfgevkaypakiegieaavvvperthyped 95 V+sGlgeG+yy+s+++ykeqf ++lgfeP+pGTLN++ld +s+++rk+le++ +ie++gf+ +ertfg+v+ +p++i+g +a+v p+rthyped WP_062266039.1 99 VISGLGEGRYYMSIPHYKEQFGKHLGFEPFPGTLNIRLDPASIQVRKQLEHIGWIEVPGFTADERTFGGVRTLPCRIRGEFCAIVEPSRTHYPED 193 89********************************************************************************************* PP CTP-dep_RFKase 96 vlEiiapvkLReklelkdgdeveiev 121 ++E+ia +LR+ l+l+d+d++e+e+ WP_062266039.1 194 IIEVIAGCELRKVLDLNDNDMIEVEI 219 ************************97 PP
Or compare WP_062266039.1 to CDD or PaperBLAST