WP_077076344.1 has 229 amino acids
Query: CTP-dep_RFKase [M=121] Accession: PF01982.20 Description: Domain of unknown function DUF120 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-46 142.8 0.0 3.9e-46 142.3 0.0 1.2 1 WP_077076344.1 Domain annotation for each sequence (and alignments): >> WP_077076344.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 142.3 0.0 3.9e-46 3.9e-46 1 120 [. 106 224 .. 106 225 .. 0.99 Alignments for each domain: == domain 1 score: 142.3 bits; conditional E-value: 3.9e-46 CTP-dep_RFKase 1 VvsGlgeGkyyvslegykeqfeeklgfePypGTLNvkldeeslelrkaleklkgieiegfeeeertfgevkaypakiegieaavvvperthyped 95 V sGlgeG+yyvs++ y qf+eklg+ PypGTLNvk+ +e++++ ++l++ +gi iegfe+++rt+g+vka+ ++i+++e+a ++p r+ y +d WP_077076344.1 106 VSSGLGEGRYYVSKKPYVVQFSEKLGIIPYPGTLNVKILSEDESKLRMLRANEGILIEGFESDDRTYGDVKAFGCRIKNVECAAIFPYRSVY-KD 199 789*****************************************************************************************.9* PP CTP-dep_RFKase 96 vlEiiapvkLReklelkdgdeveie 120 ++Eii++++LRekl+l+dgd v+i+ WP_077076344.1 200 IIEIISSEYLREKLSLNDGDLVKID 224 ***********************95 PP
Or compare WP_077076344.1 to CDD or PaperBLAST