WP_080713519.1 has 447 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-15 43.4 0.0 2.9e-15 42.6 0.0 1.4 1 WP_080713519.1 Domain annotation for each sequence (and alignments): >> WP_080713519.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.6 0.0 2.9e-15 2.9e-15 20 148 .. 175 297 .. 169 352 .. 0.81 Alignments for each domain: == domain 1 score: 42.6 bits; conditional E-value: 2.9e-15 UPF0020 20 lvrlagwkdgepllDPmCGsGtilIEaallganiapgllrefvyelkaeaeeearaelk.lygsDldrrvvqgareNaekagvgd.liefsqada 112 +v + ++++++ DP CG+ ++lI a +++ p +l + + + +++ + + g+D+d+ +++ a N g+++ ++++++ WP_080713519.1 175 MVDMVAPQPTDTICDPACGTAGFLIGASEYVRDHHPEAL--------TDQQLRHHYHHEmFHGFDFDSTMLRIASMNMLLHGIEGaEVQYRDSLS 261 999999*********************999999998665........44455555444469**********************873577888777 PP UPF0020 113 akLrlkegevdvivtnpPYGerlgskkalekLYsef 148 +eg++ ++++npP+ +l+ + + ++L + + WP_080713519.1 262 EGAADDEGSYSLVLANPPFAGSLDYESTSKDLQQVV 297 77778999****************999999997754 PP
Or compare WP_080713519.1 to CDD or PaperBLAST