WP_088062182.1 has 105 amino acids
Query: DUF485 [M=89]
Accession: PF04341.16
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.3e-37 111.6 0.4 8.3e-37 111.4 0.4 1.0 1 WP_088062182.1
Domain annotation for each sequence (and alignments):
>> WP_088062182.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 111.4 0.4 8.3e-37 8.3e-37 2 89 .] 14 101 .. 13 101 .. 0.98
Alignments for each domain:
== domain 1 score: 111.4 bits; conditional E-value: 8.3e-37
DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYflfvllvafapdllatkvvegnitvgillgllqfvltfvltglYvrrAnrefDplaeeire 89
a+pk+++L+r+r+ ++++lt+++l+ Yf+++ l+af++++lat++++g++++gi+++++++v+t+v+t++YvrrAn+++D+l+++i+e
WP_088062182.1 14 ANPKYHALKRQRNALGWTLTVLMLLAYFGYIGLIAFDKTFLATPIGDGVTSIGIPIAIGVMVFTIVITAIYVRRANNTYDQLTAQILE 101
79***********************************************************************************985 PP
Or compare WP_088062182.1 to CDD or PaperBLAST