PaperBLAST – Find papers about a protein or its homologs

 

Align WP_096060128.1 to PF04304 (DUF454)

WP_096060128.1 has 134 amino acids

Query:       DUF454  [M=115]
Accession:   PF04304.17
Description: Protein of unknown function (DUF454)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.1e-46  143.8   7.1    1.3e-46  143.6   7.1    1.0  1  WP_096060128.1  


Domain annotation for each sequence (and alignments):
>> WP_096060128.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  143.6   7.1   1.3e-46   1.3e-46       1     115 []      15     129 ..      15     129 .. 0.99

  Alignments for each domain:
  == domain 1  score: 143.6 bits;  conditional E-value: 1.3e-46
          DUF454   1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwv 95 
                     r+l++++ +ls++lGviGi+lP+LPTtpFlLlAa+cfarsspr+++wL++h+ +gp i d+ e+++iplk Kv a+ +m+ls+++s++lv+++w+
  WP_096060128.1  15 RYLFMAVVWLSVVLGVIGIFLPVLPTTPFLLLAAACFARSSPRFYHWLINHPQLGPWIGDYLEGNGIPLKGKVYAVGMMWLSIGLSCYLVAQPWA 109
                     799******************************************************************************************** PP

          DUF454  96 killalvlllvllyllrlpt 115
                     ++++++ ++lv++y+lr +t
  WP_096060128.1 110 RAFMLTSAVLVTIYILRQKT 129
                     ***************99886 PP



Or compare WP_096060128.1 to CDD or PaperBLAST