WP_096060128.1 has 134 amino acids
Query: DUF454 [M=115] Accession: PF04304.17 Description: Protein of unknown function (DUF454) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-46 143.8 7.1 1.3e-46 143.6 7.1 1.0 1 WP_096060128.1 Domain annotation for each sequence (and alignments): >> WP_096060128.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 143.6 7.1 1.3e-46 1.3e-46 1 115 [] 15 129 .. 15 129 .. 0.99 Alignments for each domain: == domain 1 score: 143.6 bits; conditional E-value: 1.3e-46 DUF454 1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwv 95 r+l++++ +ls++lGviGi+lP+LPTtpFlLlAa+cfarsspr+++wL++h+ +gp i d+ e+++iplk Kv a+ +m+ls+++s++lv+++w+ WP_096060128.1 15 RYLFMAVVWLSVVLGVIGIFLPVLPTTPFLLLAAACFARSSPRFYHWLINHPQLGPWIGDYLEGNGIPLKGKVYAVGMMWLSIGLSCYLVAQPWA 109 799******************************************************************************************** PP DUF454 96 killalvlllvllyllrlpt 115 ++++++ ++lv++y+lr +t WP_096060128.1 110 RAFMLTSAVLVTIYILRQKT 129 ***************99886 PP
Or compare WP_096060128.1 to CDD or PaperBLAST