WP_101756294.1 has 180 amino acids
Query: DUF4123 [M=123] Accession: PF13503.10 Description: Domain of unknown function (DUF4123) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-24 70.4 0.0 1.1e-23 70.0 0.0 1.2 1 WP_101756294.1 Domain annotation for each sequence (and alignments): >> WP_101756294.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.0 0.0 1.1e-23 1.1e-23 1 121 [. 22 150 .. 22 152 .. 0.81 Alignments for each domain: == domain 1 score: 70.0 bits; conditional E-value: 1.1e-23 DUF4123 1 lYaLlDg.aadpellelleaesgeaase....LyagtpeeelaevgPwLveledaselsallr......leeegwgpslglllaSaapleelarh 84 lYa++D+ a +p +l + + + L+++tpee + + +P+L +e+ s++++ l + + +++ ++l+S++pl el +h WP_101756294.1 22 LYAIIDMaAFNPLTRMELDRKQKIGCFTysvsLFENTPEEIYPDLAPHLCLIESP---SFDADedalnyLHKSEKVRNAVIWLWSSYPLIELQKH 113 7******444555555565555555444778************************...555555566675555555555556************* PP DUF4123 85 LrsllqvrlpdgeavllRfydprvlrallptldeeqr 121 L+ +l+ + +g++vl+Rfydprv++a+ ++l e q WP_101756294.1 114 LQIFLNSSMKNGREVLFRFYDPRVMPAFFNILQEYQA 150 ********************************98876 PP
Or compare WP_101756294.1 to CDD or PaperBLAST