WP_101756294.1 has 180 amino acids
Query: DUF4123 [M=119] Accession: PF13503.11 Description: Domain of unknown function (DUF4123) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-24 71.5 0.0 5.1e-24 71.0 0.0 1.2 1 WP_101756294.1 Domain annotation for each sequence (and alignments): >> WP_101756294.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.0 0.0 5.1e-24 5.1e-24 1 117 [. 22 150 .. 22 152 .. 0.83 Alignments for each domain: == domain 1 score: 71.0 bits; conditional E-value: 5.1e-24 DUF4123 1 lYallDgaldpel.lellealsgeaase....LyagtpeeelaevgPwLveledasallr........eeegwgpslgwllaSalplealaahlr 82 lYa++D+a+ + l + +l + + + L+++tpee + + +P+L +e+ s++++ + e+ ++++ w l+S++pl +l++hl+ WP_101756294.1 22 LYAIIDMAAFNPLtRMELDRKQKIGCFTysvsLFENTPEEIYPDLAPHLCLIESPSFDADedalnylhKSEKVRNAVIW-LWSSYPLIELQKHLQ 115 7******666555144555555555444777************************776667777788666666666666.*************** PP DUF4123 83 sllqvrlpdgeevllRfydprvlrallqtldeeqr 117 +l+ +++g+evl+Rfydprv++a++++l e q+ WP_101756294.1 116 IFLNSSMKNGREVLFRFYDPRVMPAFFNILQEYQA 150 *****************************998876 PP
Or compare WP_101756294.1 to CDD or PaperBLAST