WP_108155204.1 has 100 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.4e-11 29.7 0.0 4.3e-11 29.4 0.0 1.2 1 WP_108155204.1
Domain annotation for each sequence (and alignments):
>> WP_108155204.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 29.4 0.0 4.3e-11 4.3e-11 1 51 [. 29 79 .. 29 93 .. 0.93
Alignments for each domain:
== domain 1 score: 29.4 bits; conditional E-value: 4.3e-11
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlre 51
R++Id++D++++ L+ eR++++ i e++ ++g ++ +Re e+l++ +
WP_108155204.1 29 RERIDALDNRIIGLIRERVAFSAMIQEARIASGGRRVNLSREMEILSHYSD 79
99********************************************99877 PP
Or compare WP_108155204.1 to CDD or PaperBLAST