WP_118914823.1 has 130 amino acids
Query: DUF4186 [M=109]
Accession: PF13811.10
Description: Domain of unknown function (DUF4186)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.5e-51 157.5 0.5 6.4e-51 157.3 0.5 1.0 1 WP_118914823.1
Domain annotation for each sequence (and alignments):
>> WP_118914823.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 157.3 0.5 6.4e-51 6.4e-51 2 108 .. 13 119 .. 12 120 .. 0.98
Alignments for each domain:
== domain 1 score: 157.3 bits; conditional E-value: 6.4e-51
DUF4186 2 elferlskskfrskFklkekdkeyleekGletikehardliakrlapaependgkqtPmrghpvfvaqHAtatCCRgclekwhkipkgreLteee 96
+ ++r+ ++fr++F+l+ +d+++++ +G++ti++ha+dl a+rlapa+p+ndg+qtP+rghpvfvaqHAtatCCR+cl++wh+ip+g+eLt +e
WP_118914823.1 13 ARLRRIGAHHFRARFHLRGRDRAIVDLRGIHTIRKHAEDLTAQRLAPARPRNDGRQTPYRGHPVFVAQHATATCCRTCLARWHGIPAGHELTVDE 107
56899****************************************************************************************** PP
DUF4186 97 qeyiveviaewl 108
+y+ve i++w+
WP_118914823.1 108 RAYVVEAICRWI 119
***********9 PP
Or compare WP_118914823.1 to CDD or PaperBLAST