WP_133416153.1 has 266 amino acids
Query: DUF4123 [M=119] Accession: PF13503.11 Description: Domain of unknown function (DUF4123) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-28 85.6 0.0 2.6e-28 84.9 0.0 1.4 1 WP_133416153.1 Domain annotation for each sequence (and alignments): >> WP_133416153.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 84.9 0.0 2.6e-28 2.6e-28 2 118 .. 6 118 .. 5 119 .. 0.98 Alignments for each domain: == domain 1 score: 84.9 bits; conditional E-value: 2.6e-28 DUF4123 2 YallDgaldpellellealsgeaaseLyagtpeeelaevgPwLveledasallreeegwgpslgwllaSalplealaahlrsllqvrlpdgeevl 96 Y+++++++d+e++e++++++g +a +Ly +t++++ +e+gPwL++++ +++l +++ +g+ + ++++e+ ++h++sl++++l dge vl WP_133416153.1 6 YLVVNPLEDKEVIERFYHYGGGNAFPLYLDTEFDAQKEIGPWLLPYPAEEFL---GYFANKPSGFRIYFSDDIETHIQHWKSLTFAGL-DGELVL 96 9*************************************************98...6********************************.****** PP DUF4123 97 lRfydprvlrallqtldeeqrs 118 +R+yd vl+a+l++++++++s WP_133416153.1 97 FRYYDRVVLEAMLASFNQKELS 118 *****************99975 PP
Or compare WP_133416153.1 to CDD or PaperBLAST