WP_134312300.1 has 73 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-23 67.5 0.1 4.4e-23 67.3 0.1 1.0 1 WP_134312300.1
Domain annotation for each sequence (and alignments):
>> WP_134312300.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 67.3 0.1 4.4e-23 4.4e-23 1 48 [. 24 71 .. 24 72 .. 0.97
Alignments for each domain:
== domain 1 score: 67.3 bits; conditional E-value: 4.4e-23
DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIk 48
p+++t++DG++i+++++P++D ++G+ye e+++Gk+++ nkd+V++Ik
WP_134312300.1 24 PTIVTLNDGREIQAVDTPRYDRSSGFYELEQLDGKRTRANKDQVRSIK 71
679********************************************8 PP
Or compare WP_134312300.1 to CDD or PaperBLAST