PaperBLAST – Find papers about a protein or its homologs

 

Align WP_138246999.1 to PF06634 (DUF1156)

WP_138246999.1 has 965 amino acids

Query:       DUF1156  [M=73]
Accession:   PF06634.16
Description: Protein of unknown function (DUF1156)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.6e-12   32.3   0.2    1.5e-10   27.4   0.1    2.5  2  WP_138246999.1  


Domain annotation for each sequence (and alignments):
>> WP_138246999.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.4   0.1   1.5e-10   1.5e-10       2      49 ..      27      74 ..      26      86 .. 0.91
   2 ?    2.1   0.0     0.012     0.012      12      31 ..     100     119 ..      94     127 .. 0.83

  Alignments for each domain:
  == domain 1  score: 27.4 bits;  conditional E-value: 1.5e-10
         DUF1156  2 lPldkinaesakEksirhgqhlstLhlwWaRrPLaavRAvilaqLvpa 49
                    lPl++++ e  kE + +h    + +h w aRrP  a+R +il++ +++
  WP_138246999.1 27 LPLKAVGIENLKEANPKHMPPHRYIHPWFARRPTPAARLAILGSVMEE 74
                    8******************99999**********************98 PP

  == domain 2  score: 2.1 bits;  conditional E-value: 0.012
         DUF1156  12 akEksirhgqhlstLhlwWa 31 
                      +E+++ +gq+  tL+ w++
  WP_138246999.1 100 VQERKTTEGQRDGTLGEWYG 119
                     58****************96 PP



Or compare WP_138246999.1 to CDD or PaperBLAST