WP_138246999.1 has 965 amino acids
Query: DUF1156 [M=73] Accession: PF06634.16 Description: Protein of unknown function (DUF1156) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-12 32.3 0.2 1.5e-10 27.4 0.1 2.5 2 WP_138246999.1 Domain annotation for each sequence (and alignments): >> WP_138246999.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.4 0.1 1.5e-10 1.5e-10 2 49 .. 27 74 .. 26 86 .. 0.91 2 ? 2.1 0.0 0.012 0.012 12 31 .. 100 119 .. 94 127 .. 0.83 Alignments for each domain: == domain 1 score: 27.4 bits; conditional E-value: 1.5e-10 DUF1156 2 lPldkinaesakEksirhgqhlstLhlwWaRrPLaavRAvilaqLvpa 49 lPl++++ e kE + +h + +h w aRrP a+R +il++ +++ WP_138246999.1 27 LPLKAVGIENLKEANPKHMPPHRYIHPWFARRPTPAARLAILGSVMEE 74 8******************99999**********************98 PP == domain 2 score: 2.1 bits; conditional E-value: 0.012 DUF1156 12 akEksirhgqhlstLhlwWa 31 +E+++ +gq+ tL+ w++ WP_138246999.1 100 VQERKTTEGQRDGTLGEWYG 119 58****************96 PP
Or compare WP_138246999.1 to CDD or PaperBLAST