PaperBLAST – Find papers about a protein or its homologs

 

Align WP_150065648.1 to PF13427 (AadA_C)

WP_150065648.1 has 271 amino acids

Query:       AadA_C  [M=103]
Accession:   PF13427.10
Description: Aminoglycoside adenylyltransferase, C-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.5e-12   32.1   0.1    1.5e-11   30.7   0.0    1.7  2  WP_150065648.1  


Domain annotation for each sequence (and alignments):
>> WP_150065648.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   30.7   0.0   1.5e-11   1.5e-11      24      85 ..     176     237 ..     163     251 .. 0.84
   2 ?   -3.0   0.0      0.46      0.46      70      80 ..     256     266 ..     254     270 .. 0.80

  Alignments for each domain:
  == domain 1  score: 30.7 bits;  conditional E-value: 1.5e-11
          AadA_C  24 eeieederyvvLtLaRvlatletgeilsKdeAaewalerlPeeyrpllaeArkaylgeeeek 85 
                     +  ++ +  +v  +aR  +tl+tg i+sKd A++ al+ +Pe+++++++  +++++ e++++
  WP_150065648.1 176 ARTDAATAWTVTGVARLHYTLSTGDITSKDGAGRHALRVFPEQWHRVVRGGLRVHRAENDQS 237
                     55666777888889************************************999999976665 PP

  == domain 2  score: -3.0 bits;  conditional E-value: 0.46
          AadA_C  70 llaeArkaylg 80 
                     ++a A ++y +
  WP_150065648.1 256 VIADAHRCYAE 266
                     8999*****87 PP



Or compare WP_150065648.1 to CDD or PaperBLAST