WP_150473362.1 has 441 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-51 158.8 1.2 8.1e-51 157.9 1.2 1.5 1 WP_150473362.1 Domain annotation for each sequence (and alignments): >> WP_150473362.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 157.9 1.2 8.1e-51 8.1e-51 2 145 .] 278 421 .. 277 421 .. 0.98 Alignments for each domain: == domain 1 score: 157.9 bits; conditional E-value: 8.1e-51 EryCIII-like_C 2 avldqvaelDaEivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivls 96 vl++v lD E+v++ld+++r l+++pdnvRlvd+vPl++llptcaaivHhgGag++ tal GvPq+ ++ +da ra+r +++Gag+ l+ WP_150473362.1 278 LVLKAVEGLDIEVVATLDAEERALLTHVPDNVRLVDHVPLHALLPTCAAIVHHGGAGTWSTALVEGVPQIAMGWIWDAIDRAQRQQAMGAGLHLP 372 58999****************************************************************************************** PP EryCIII-like_C 97 kdeltsdsiakavaevvedpayraaaaklaeeiaaePsPtEvakkleel 145 +e+t + ++ + +++++p+++aaa++l++e+ +eP+P+ v++ le l WP_150473362.1 373 SHEVTVEGLRGRLVRLLDEPSFTAAAGRLRAEAESEPTPAQVVPVLERL 421 *******************************************999876 PP
Or compare WP_150473362.1 to CDD or PaperBLAST