WP_150774123.1 has 126 amino acids
Query: DUF1090 [M=110]
Accession: PF06476.16
Description: Protein of unknown function (DUF1090)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.2e-26 77.8 10.1 3.6e-26 77.7 10.1 1.0 1 WP_150774123.1
Domain annotation for each sequence (and alignments):
>> WP_150774123.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.7 10.1 3.6e-26 3.6e-26 12 109 .. 24 121 .. 12 122 .. 0.95
Alignments for each domain:
== domain 1 score: 77.7 bits; conditional E-value: 3.6e-26
DUF1090 12 aaalsgCaaKaqaiekqlsaAkahgnkarvagLekalaevkanCtdaslreereqkvaekeeevaereaeLaeaqekgdadkiakrqkkLaeaqe 106
a+a + Ca +++++ +q++ A+a++n r agLe+ala+v+ +C++ s+ +++e++++++e+e+++r++ L++a++ gd + i+k++++L++aq+
WP_150774123.1 24 ADARQSCAPRRAELVRQIERANAADNVYRKAGLEQALANVERYCREPSVEDDHEKAIQKAEAEIRRRQNHLKAARQYGDVKVIKKQEARLERAQA 118
567899***************************************************************************************** PP
DUF1090 107 eLk 109
+L+
WP_150774123.1 119 KLQ 121
**8 PP
Or compare WP_150774123.1 to CDD or PaperBLAST