WP_165489581.1 has 122 amino acids
Query: DUF423 [M=87]
Accession: PF04241.19
Description: Protein of unknown function (DUF423)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.3e-36 109.3 1.3 4.3e-36 109.3 1.3 1.5 2 WP_165489581.1
Domain annotation for each sequence (and alignments):
>> WP_165489581.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 109.3 1.3 4.3e-36 4.3e-36 2 87 .] 19 103 .. 18 103 .. 0.98
2 ? -3.0 0.2 0.5 0.5 52 58 .. 107 113 .. 104 117 .. 0.55
Alignments for each domain:
== domain 1 score: 109.3 bits; conditional E-value: 4.3e-36
DUF423 2 GAfGaHglkkkleeeqlevfetavqYqlyhalallavallaeaaaakllklagllflaGivlFSgslyllaltgdkllgaitPiGG 87
GAfGaH+l++kl+e++++v+e+a++Yq+yh+l+l++++++ + +++ +++ag+l+++Giv+FSgsly+lalt++++lgaitPiGG
WP_165489581.1 19 GAFGAHVLEDKLNEKYISVWEKATTYQMYHGLVLILIGII-SGTTSMNVNWAGWLMFLGIVFFSGSLYILALTEIRILGAITPIGG 103
9**********999*************************9.8999****************************************9 PP
== domain 2 score: -3.0 bits; conditional E-value: 0.5
DUF423 52 lagllfl 58
+ag+l+l
WP_165489581.1 107 IAGWLML 113
4555554 PP
Or compare WP_165489581.1 to CDD or PaperBLAST