WP_198409083.1 has 139 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-24 72.6 0.2 2.4e-24 71.9 0.1 1.4 1 WP_198409083.1
Domain annotation for each sequence (and alignments):
>> WP_198409083.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 71.9 0.1 2.4e-24 2.4e-24 1 78 [. 48 125 .. 48 127 .. 0.96
Alignments for each domain:
== domain 1 score: 71.9 bits; conditional E-value: 2.4e-24
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+++d+i++ l++Ll eRm+++ +iae+K+++++p+++p+R +vl++l+++ + gl p++v+++f+ ii+e++ ++
WP_198409083.1 48 RDQLDRINNHLVDLLGERMSVCMDIAELKAAHDIPMMQPQRIVQVLDQLKDKSSTVGLRPDYVQSVFKLIIEETCIQE 125
99*************************************************9999*****************987555 PP
Or compare WP_198409083.1 to CDD or PaperBLAST