WP_208666552.1 has 102 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-21 62.3 0.0 2.6e-21 62.1 0.0 1.0 1 WP_208666552.1
Domain annotation for each sequence (and alignments):
>> WP_208666552.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 62.1 0.0 2.6e-21 2.6e-21 1 78 [. 14 90 .. 14 91 .. 0.96
Alignments for each domain:
== domain 1 score: 62.1 bits; conditional E-value: 2.6e-21
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+ Id +Dr++++ l Rm+++k++ +K ++ ++ p+R++ +l ++r++a+e+gld e++e +f+++i++ +a Q
WP_208666552.1 14 RHAIDTLDRQIIDALGLRMHYVKAASSFKPDQA-SIAAPDRVASMLPQRRRWAQEAGLDGEFIEGLFNQVIHWYIAEQ 90
899**************************7666.9****************************************999 PP
Or compare WP_208666552.1 to CDD or PaperBLAST