WP_229516432.1 has 164 amino acids
Query: DUF4863 [M=153] Accession: PF16155.10 Description: Domain of unknown function (DUF4863) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-50 157.8 0.0 1.2e-50 157.6 0.0 1.0 1 WP_229516432.1 Domain annotation for each sequence (and alignments): >> WP_229516432.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 157.6 0.0 1.2e-50 1.2e-50 4 153 .] 16 158 .. 13 158 .. 0.97 Alignments for each domain: == domain 1 score: 157.6 bits; conditional E-value: 1.2e-50 DUF4863 4 aeflaeiedltldkeleerLneeygagselyedlaalirqgvaegWvakeeidGakyrrgriakpseetkgfsidvveleeedvagqyHrHPyGe 98 + + ++i+ ++ld++le++Ln++yg g+e y l++l++ gv+egWva ei+G +yrrgria+ps+et+++s++ l dv+gqyH H Ge WP_229516432.1 16 RGLCDDIRVMPLDAALEAHLNSKYGDGTEAYGRLVKLLKLGVEEGWVAYVEIEGGDYRRGRIAEPSQETSNMSVESGLLR--DVKGQYHCHTTGE 108 56789999************************************************************************..************* PP DUF4863 99 inlvvpldesaelkglegwqgaGWtvpgpgsaHyPevrgGaavvlflLPaGriey 153 in+++pl+e+a+++g+ aGW v+ p s+H P+v+ G+a+++++LP G iey WP_229516432.1 109 INMIIPLEEGAQFCGHG----AGWRVFPPLSEHFPTVT-GRALMMYFLPGGDIEY 158 ****************9....***************97.8999**********99 PP
Or compare WP_229516432.1 to CDD or PaperBLAST