WP_229516432.1 has 164 amino acids
Query: DUF4863 [M=147] Accession: PF16155.9 Description: Domain of unknown function (DUF4863) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-53 165.3 0.0 4.8e-53 165.1 0.0 1.0 1 WP_229516432.1 Domain annotation for each sequence (and alignments): >> WP_229516432.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 165.1 0.0 4.8e-53 4.8e-53 4 147 .] 16 158 .. 13 158 .. 0.97 Alignments for each domain: == domain 1 score: 165.1 bits; conditional E-value: 4.8e-53 DUF4863 4 aevlaeiedltldkaleerLneeygagselyedlaalirqgvaegWvakreidGakirrgriikpseetkgfsvdvveledvagqyHaHPyGeid 98 + + ++i+ ++ld+ale++Ln++yg g+e y l++l++ gv+egWva ei+G ++rrgri++ps+et+++sv+ l dv+gqyH H Gei+ WP_229516432.1 16 RGLCDDIRVMPLDAALEAHLNSKYGDGTEAYGRLVKLLKLGVEEGWVAYVEIEGGDYRRGRIAEPSQETSNMSVESGLLRDVKGQYHCHTTGEIN 110 6788999**************************************************************************************** PP DUF4863 99 lvvpldesaelkgleaGWtvygpgsaHrPtvrgGaalvlflLPaGrief 147 +++pl+e+a++ g+ aGW v+ p s+H Ptv+ G+al++++LP G ie+ WP_229516432.1 111 MIIPLEEGAQFCGHGAGWRVFPPLSEHFPTVT-GRALMMYFLPGGDIEY 158 ******************************97.89************99 PP
Or compare WP_229516432.1 to CDD or PaperBLAST