WP_231730012.1 has 987 amino acids
Query: DUF1156 [M=73]
Accession: PF06634.16
Description: Protein of unknown function (DUF1156)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-27 82.4 0.1 2.8e-27 81.0 0.1 1.7 1 WP_231730012.1
Domain annotation for each sequence (and alignments):
>> WP_231730012.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 81.0 0.1 2.8e-27 2.8e-27 2 52 .. 3 52 .. 2 66 .. 0.89
Alignments for each domain:
== domain 1 score: 81.0 bits; conditional E-value: 2.8e-27
DUF1156 2 lPldkinaesakEksirhgqhlstLhlwWaRrPLaavRAvilaqLvpapss 52
+P++++++++a+Eksirhg h+stLhlwWaRrPLa +RAv+l+ L p+p
WP_231730012.1 3 FPIAEVSKQAAREKSIRHG-HPSTLHLWWARRPLASCRAVLLGLLFPDPCD 52
9******************.****************************976 PP
Or compare WP_231730012.1 to CDD or PaperBLAST