WP_285891545.1 has 78 amino acids
Query: DUF559 [M=109] Accession: PF04480.18 Description: Protein of unknown function (DUF559) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-25 73.5 0.2 6.9e-25 73.3 0.2 1.0 1 WP_285891545.1 Domain annotation for each sequence (and alignments): >> WP_285891545.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.3 0.2 6.9e-25 6.9e-25 41 107 .. 1 67 [. 1 69 [. 0.97 Alignments for each domain: == domain 1 score: 73.3 bits; conditional E-value: 6.9e-25 ETTEEEEEEETTTTEEEEEE-----------HHHHHHHHHTT-EEEEEEHHHHHH-HHHHHHHHHHH CS DUF559 41 igsYivDfvclkaklivelDGaqhdeeeeyDaeRtelLeslGftvlRfkndevlknieevleeilka 107 +g++ivDf+c + kli+e+DG+ hd+++eyD+ R+e L+++ + vlRf nd+v n +vle+i ++ WP_285891545.1 1 MGNFIVDFYCPQLKLIIEVDGSIHDNQREYDQCRSEKLKEFVHYVLRFTNDQVIDNLPKVLEKITQT 67 799*************************************************************986 PP
Or compare WP_285891545.1 to CDD or PaperBLAST