WP_305015901.1 has 229 amino acids
Query: DUF1751 [M=99]
Accession: PF08551.14
Description: Eukaryotic integral membrane protein (DUF1751)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.1e-10 26.8 0.5 8.2e-10 25.5 0.5 1.8 1 WP_305015901.1
Domain annotation for each sequence (and alignments):
>> WP_305015901.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 25.5 0.5 8.2e-10 8.2e-10 8 79 .. 60 130 .. 52 144 .. 0.89
Alignments for each domain:
== domain 1 score: 25.5 bits; conditional E-value: 8.2e-10
DUF1751 8 pwtlltasfvelnvfkvlvslltLllggkylErlWgskEllkFilvvnvitnllvvlltlllylvtkseell 79
w llt f + ++++++++ltL+++g + E + g++ +l l+ +v+ n++ +l++ l++ v s l
WP_305015901.1 60 YWRLLTPIFLHAGWLHIITNMLTLWFIGPLAEAVFGHRKFLGLYLFGGVVGNIMSYLFAPLTVSVGASTA-L 130
59********************************************************999988877766.4 PP
Or compare WP_305015901.1 to CDD or PaperBLAST