PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001120888.2 to PF15061 (DUF4538)

XP_001120888.2 has 58 amino acids

Query:       DUF4538  [M=57]
Accession:   PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-16   46.5   0.4    1.9e-16   45.9   0.1    1.5  2  XP_001120888.2  


Domain annotation for each sequence (and alignments):
>> XP_001120888.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   45.9   0.1   1.9e-16   1.9e-16       3      40 ..       5      42 ..       3      51 .. 0.92
   2 ?   -1.3   0.0      0.11      0.11      30      40 ..      47      57 ..      45      58 .] 0.76

  Alignments for each domain:
  == domain 1  score: 45.9 bits;  conditional E-value: 1.9e-16
         DUF4538  3 glkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQk 40
                    g++ya+++g+fVg ig+ +Y  +i+Pm++pe Yk+i +
  XP_001120888.2  5 GWRYAAFIGTFVGTIGIFCYFTMISPMINPEPYKRIRE 42
                    9*********************************9976 PP

  == domain 2  score: -1.3 bits;  conditional E-value: 0.11
         DUF4538 30 lhpeeYkkiQk 40
                    +h   Yk++ +
  XP_001120888.2 47 SHNKTYKNSKE 57
                    58889998876 PP



Or compare XP_001120888.2 to CDD or PaperBLAST