XP_001120888.2 has 58 amino acids
Query: DUF4538 [M=57]
Accession: PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-16 46.5 0.4 1.9e-16 45.9 0.1 1.5 2 XP_001120888.2
Domain annotation for each sequence (and alignments):
>> XP_001120888.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 45.9 0.1 1.9e-16 1.9e-16 3 40 .. 5 42 .. 3 51 .. 0.92
2 ? -1.3 0.0 0.11 0.11 30 40 .. 47 57 .. 45 58 .] 0.76
Alignments for each domain:
== domain 1 score: 45.9 bits; conditional E-value: 1.9e-16
DUF4538 3 glkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQk 40
g++ya+++g+fVg ig+ +Y +i+Pm++pe Yk+i +
XP_001120888.2 5 GWRYAAFIGTFVGTIGIFCYFTMISPMINPEPYKRIRE 42
9*********************************9976 PP
== domain 2 score: -1.3 bits; conditional E-value: 0.11
DUF4538 30 lhpeeYkkiQk 40
+h Yk++ +
XP_001120888.2 47 SHNKTYKNSKE 57
58889998876 PP
Or compare XP_001120888.2 to CDD or PaperBLAST