XP_001240575.1 has 209 amino acids
Query: BIM1-like_dom [M=140] Accession: PF20238.2 Description: Copper acquisition factor BIM1-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-43 134.1 0.3 3.1e-43 133.8 0.3 1.1 1 XP_001240575.1 Domain annotation for each sequence (and alignments): >> XP_001240575.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 133.8 0.3 3.1e-43 3.1e-43 1 139 [. 15 155 .. 15 156 .. 0.91 Alignments for each domain: == domain 1 score: 133.8 bits; conditional E-value: 3.1e-43 BIM1-like_dom 1 sahfallyPpsrgfdedkentaPCGgfasvgnrtefpltggavlllsshpsanvavrlslgnptsnsdfntlleppvvqetgaGhfClpkvdlps 95 sahf+++yP +rg++ +++ t PCGg++ ++nrte+p++gg++l + hp+a ++v+l++gn++s f++ l p+++q+ g+G++C++k+++p+ XP_001240575.1 15 SAHFHVDYPYWRGDSFKTQYTRPCGGVNVTTNRTEWPVNGGSLLFSAGHPWAITYVNLGIGNDDS-VIFDVPLIPAFNQT-GNGTVCFSKIQVPE 107 69*****************************************77777*************8555.59999999999999.************** PP BIM1-like_dom 96 s...a.Gtnatlqvvysge.g.alYqCadvtfvesasaksassstCfnst 139 + Gtna++qv++ +e g alY+Cad+tf+ ++a ss++C+nst XP_001240575.1 108 GtqiSpGTNASIQVIQLSElGsALYNCADITFS--DNAGLLSSDKCQNST 155 ***956**********5555558**********..5555699*******9 PP
Or compare XP_001240575.1 to CDD or PaperBLAST