XP_001351738.1 has 1379 amino acids
Query: DUF559 [M=109] Accession: PF04480.16 Description: Protein of unknown function (DUF559) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-09 23.4 0.2 1.2e-08 21.1 0.0 2.3 2 XP_001351738.1 Domain annotation for each sequence (and alignments): >> XP_001351738.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.0 0.19 0.19 17 56 .. 550 589 .. 546 591 .. 0.72 2 ! 21.1 0.0 1.2e-08 1.2e-08 4 86 .. 1254 1346 .. 1252 1350 .. 0.81 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.19 DUF559 17 aekkLWrllrnrrlsglkfrRqkpigsYivDfvclkakli 56 ++ +W+++++++++++ + + i i f ++k+ li XP_001351738.1 550 KDPDIWKYIKKQFYENINNFKAQEISIIIWSFGSIKNELI 589 56679*******9999875555556777777777776665 PP == domain 2 score: 21.1 bits; conditional E-value: 1.2e-08 DUF559 4 kanarklRreq.teaekkLWrllrn..rrlsglkfrRqkpigsYivDfvclkaklivelDGaqhdee.......eeyDaeRtelLeslGftvl 86 k+ ar+ R+eq t+ ++ +++ n rrl+ ++++ +++s +vD + + k+++e+DG +h + +++ +++lL +lG+tv+ XP_001351738.1 1254 KQLARNQRKEQkTHISSSVHKKISNdlRRLNIFHYNEYFILDSILVDIFIPHSKIVIEIDGPNHFFQkgemifyKSNTLFKKRLLRALGYTVI 1346 67788888876366778888888874469***********************************87655555555566678899999999997 PP
Or compare XP_001351738.1 to CDD or PaperBLAST