XP_001898422.1 has 175 amino acids
Query: Cg6151-P [M=113]
Accession: PF10233.13
Description: Uncharacterized conserved protein CG6151-P
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.7e-30 91.2 9.6 3.3e-30 91.0 9.6 1.1 1 XP_001898422.1
Domain annotation for each sequence (and alignments):
>> XP_001898422.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 91.0 9.6 3.3e-30 3.3e-30 1 113 [] 33 142 .. 33 142 .. 0.98
Alignments for each domain:
== domain 1 score: 91.0 bits; conditional E-value: 3.3e-30
Cg6151-P 1 lGilsiilcialGianiftlsvvlivfsilalvsgfvvlfiEvPlllricptsekfdefiekfetnwmraalYlvmavvqwlslivqatslivaa 95
lG+l+++++i++ ++ +++ls+++i++ +l+l++g++ +++E+P+++++++++ek++ f e++ ++w+++alY++m+v++ ++l+ +++++++++
XP_001898422.1 33 LGVLGGFVAIFFAVLGLVSLSATCIIAVLLQLAFGILTVALEAPFCCMFIDFIEKIAMFSESR-KYWQKGALYCIMGVLP-ILLC-TELNTVLGS 124
69*************************************************************.****************.8899.9******** PP
Cg6151-P 96 vlllitavlYglaalkkq 113
+++++++++Yg++al+k+
XP_001898422.1 125 GMIFASGTVYGFLALGKK 142
***************997 PP
Or compare XP_001898422.1 to CDD or PaperBLAST