XP_002808771.1 has 64 amino acids
Query: DUF4516 [M=46]
Accession: PF14990.10
Description: Domain of unknown function (DUF4516)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.4e-26 76.4 0.2 6.6e-26 76.1 0.2 1.1 1 XP_002808771.1
Domain annotation for each sequence (and alignments):
>> XP_002808771.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 76.1 0.2 6.6e-26 6.6e-26 1 45 [. 1 45 [. 1 46 [. 0.98
Alignments for each domain:
== domain 1 score: 76.1 bits; conditional E-value: 6.6e-26
DUF4516 1 mPaGvswgqYlklvsasvlSMlaGAqvVHnyYKPdltipdiekke 45
mP+Gvs+++Yl++vs+s+l+M++G+++VH+++KP+++++di+k++
XP_002808771.1 1 MPLGVSLREYLFIVSTSFLCMAMGSCCVHLIMKPEMRKVDISKHV 45
9*****************************************997 PP
Or compare XP_002808771.1 to CDD or PaperBLAST