XP_002939681.1 has 164 amino acids
Query: DUF3695 [M=101]
Accession: PF12494.12
Description: Protein of unknown function (DUF3695)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.8e-37 111.7 0.5 1.1e-36 111.0 0.5 1.3 1 XP_002939681.1
Domain annotation for each sequence (and alignments):
>> XP_002939681.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 111.0 0.5 1.1e-36 1.1e-36 5 92 .. 31 118 .. 27 126 .. 0.90
Alignments for each domain:
== domain 1 score: 111.0 bits; conditional E-value: 1.1e-36
DUF3695 5 nptklaqqlepweRLfstqtlsSvrreayffdpkiPkDsLDfrLaarYdhhteafkekneillqqeTiqdtsgrvlknfptevlsppk 92
++++l q+++pw RL+st+tlsS rr++y++dp++P DsLDf+L+++Ydhh++++k++ne+l q+eT+++++gr+lkn+ +e+ +++
XP_002939681.1 31 KSHNLPQKEDPWYRLNSTATLSSDRRAVYYYDPEAPSDSLDFTLKSLYDHHNGLLKDRNETLYQPETLTESHGRILKNRVKEIPVSQE 118
678899************************************************************************9988644443 PP
Or compare XP_002939681.1 to CDD or PaperBLAST