XP_003198200.2 has 2192 amino acids
Query: DUF3677 [M=81]
Accession: PF12432.12
Description: Protein of unknown function (DUF3677)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.7e-38 116.5 2.4 1.6e-37 114.0 2.4 2.5 1 XP_003198200.2
Domain annotation for each sequence (and alignments):
>> XP_003198200.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 114.0 2.4 1.6e-37 1.6e-37 1 81 [] 348 428 .. 348 428 .. 0.99
Alignments for each domain:
== domain 1 score: 114.0 bits; conditional E-value: 1.6e-37
DUF3677 1 llklLsslcgipevrllvasrleiwlqnpKLvreaqelLlslcvncntssekdsevidaLvklrlKtkalinlftacikel 81
ll+lL+++cg++evrl++++rle+wlqnpKL+r+aq+lL+slc+ncnt+ + d evi++L+k+rlK k l+n+++ c++el
XP_003198200.2 348 LLRLLTATCGYKEVRLMAVQRLEMWLQNPKLTRPAQDLLMSLCMNCNTHGSDDMEVISNLIKIRLKPKVLLNHYMLCVREL 428
79*****************************************************************************98 PP
Or compare XP_003198200.2 to CDD or PaperBLAST