XP_004928101.2 has 581 amino acids
Query: DUF5009 [M=260]
Accession: PF16401.11
Description: Domain of unknown function (DUF5009)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4e-11 28.9 3.8 2e-10 26.6 3.8 2.1 1 XP_004928101.2
Domain annotation for each sequence (and alignments):
>> XP_004928101.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 26.6 3.8 2e-10 2e-10 3 100 .. 193 277 .. 191 290 .. 0.82
Alignments for each domain:
== domain 1 score: 26.6 bits; conditional E-value: 2e-10
DUF5009 3 ssldalrgiaillmvlsgsiafgsilpgwmyhaqvpppahkfkpelpgitwvdlvfpfflfamgaaiplalkkkiev.ssllkillsivkryvll 96
+ld++rg+ai++m++ a g wm ha g+ dlvfp fl+ mg +ipl++k ++ + +ki+++iv+r +++
XP_004928101.2 193 RALDTFRGMAIVFMIFVNDGAGG---YWWMEHAT-----------WNGMVAGDLVFPAFLWIMGVCIPLSVKSAFAKgIPRWKIVMHIVRRSIMM 273
57999999999999988776653...46999986...........4588889*******************998765269************999 PP
DUF5009 97 affa 100
f+
XP_004928101.2 274 FFLG 277
8864 PP
Or compare XP_004928101.2 to CDD or PaperBLAST