PaperBLAST – Find papers about a protein or its homologs

 

Align XP_005096219.1 to PF15061 (DUF4538)

XP_005096219.1 has 99 amino acids

Query:       DUF4538  [M=57]
Accession:   PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.4e-21   62.3   0.2    2.2e-21   61.7   0.2    1.3  1  XP_005096219.1  


Domain annotation for each sequence (and alignments):
>> XP_005096219.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   61.7   0.2   2.2e-21   2.2e-21       2      57 .]      34      89 ..      33      89 .. 0.98

  Alignments for each domain:
  == domain 1  score: 61.7 bits;  conditional E-value: 2.2e-21
         DUF4538  2 rglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57
                    ++lk+  ++g +Vg i +A+YPIiiaP+++p    + Q++ r+gi++e+iqPggmk
  XP_005096219.1 34 KNLKSLGVIGVVVGGILVATYPIIIAPYMDPRPWHEVQNVGRQGIDREKIQPGGMK 89
                    78999**************************************************8 PP



Or compare XP_005096219.1 to CDD or PaperBLAST